You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582532 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PADI4 |
Target | PADI4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PADI4 |
Protein Sequence | Synthetic peptide located within the following region: TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL |
UniProt ID | Q9UM07 |
MW | 74 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PAD, PAD4, PDI4, PDI5, PADI5 |
Note | For research use only |
NCBI | NP_036519 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~66 kDa.
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: 721_B Cell lysates, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PADI4 is expressed in 721_B.
IF, IH, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |