PADI4 Rabbit Polyclonal Antibody

• Catalog Number: orb582532
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PADI4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PADI4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 74 kDa
• Target: PADI4
• UniProt ID: Q9UM07
• Protein Sequence: Synthetic peptide located within the following region: TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL
• NCBI: NP_036519
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PAD, PAD4, PDI4, PDI5, PADI5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~66 kDa.

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: 721_B Cell lysates, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PADI4 is expressed in 721_B.