Cart summary

You have no items in your shopping cart.

PABPC1L2A Rabbit Polyclonal Antibody (Biotin)

PABPC1L2A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2125927

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2125927
CategoryAntibodies
DescriptionPABPC1L2A Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PABPC1L2A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW23kDa
UniProt IDQ5JQF8
Protein SequenceSynthetic peptide located within the following region: NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL
NCBINP_001012995
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesRBM32A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.