PABPC1 Rabbit Polyclonal Antibody

• Catalog Number: orb577567
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PABPC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PABPC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71 kDa
• Target: PABPC1
• UniProt ID: P11940
• Protein Sequence: Synthetic peptide located within the following region: LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
• NCBI: NP_002559
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PAB1, PABP, PABP1, PABPC2, PABPL1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: Human brain stem cells (NT2), Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Red: PABPC1 Blue: DAPI, Gene Name: PABPC1.

WB Suggested Anti-PABPC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.