You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577567 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PABPC1 |
Target | PABPC1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PABPC1 |
Protein Sequence | Synthetic peptide located within the following region: LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ |
UniProt ID | P11940 |
MW | 71 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PAB1, PABP, PABP1, PABPC2, PABPL1 |
Note | For research use only |
NCBI | NP_002559 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Type: Human brain stem cells (NT2), Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Red: PABPC1 Blue: DAPI, Gene Name: PABPC1.
WB Suggested Anti-PABPC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Other, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |