PA2G4 Rabbit Polyclonal Antibody

• Catalog Number: orb580126
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PA2G4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PA2G4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: PA2G4
• UniProt ID: Q9UQ80
• Protein Sequence: Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ
• NCBI: NP_006182
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EBP1, HG4-1, p38-2G4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Lung, respiratory epithelium.

Rabbit Anti-PA2G4 Antibody, Catalog Number: orb580126, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PA2G4 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. PA2G4 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.