P53 Antibody

• Catalog Number: orb153342
• Category: Antibodies
• Description: Goat polyclonal antibody to P53. This protein reacts to diverse cellular stresses to regulate target genes that induce apoptosis, senescence, cell cycle arrest, DNA repair, or changes in metabolism. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is assumed to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumour suppressor.
• Target: Tumor protein p53
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.. Antigen Sequence: DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
• Tested applications: IF, WB
• Dilution range: WB:1:500-1:2,000, IF:1:50-1:250
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BCC7, LFS1 and TRP53 antibody.
• Note: For research use only

Western blot analysis of GFP-P53 using P53 antibody.

Confocal immunofluoroscence analysis of Hepa1-6 cells using P53 antibody.