You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb580304 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to P4HB |
| Target | P4HB |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human P4HB |
| Protein Sequence | Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV |
| UniProt ID | P07237 |
| MW | 55kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | DSI, GIT, PDI, PHDB, PDIA1, PO4DB, PO4HB, PROHB, C Read more... |
| Research Area | Cell Biology, Immunology & Inflammation, Signal Tr Read more... |
| Note | For research use only |
| NCBI | NP_000909 |

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Human kidney

WB Suggested Anti-P4HB Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate. P4HB is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
ELISA, FC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Gallus, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review