You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579776 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to OSMR |
Target | OSMR |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Guinea pig, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OSMR |
Protein Sequence | Synthetic peptide located within the following region: LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH |
UniProt ID | Q99650 |
MW | 110kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | OSMRB, PLCA1, IL-31RB, OSMRbeta, IL-31R-beta |
Note | For research use only |
NCBI | NP_003990 |
Positive control (+): Human Lung Tumor (T-LU), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/ml.
WB Suggested Anti-OSMR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.
WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |