OSGEP Rabbit Polyclonal Antibody

SKU: orb583421

Description

Rabbit polyclonal antibody to OSGEP

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSGEP
• Target: OSGEP
• Protein Sequence: Synthetic peptide located within the following region: PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA
• Molecular Weight: 36kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

KAE1, TCS3, GCPL1, GAMOS3, OSGEP1, PRSMG1

OSGEP was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb583421 with 1:200 dilution. Western blot was performed using orb583421 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: OSGEP IP with orb583421 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-OSGEP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

OSGEP

UniProt

Q9NPF4

RefSeq (Protein):NP_060277