You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327316 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ORC4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ORC4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | ORC4 |
UniProt ID | O43929 |
Protein Sequence | Synthetic peptide located within the following region: IIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEH |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ORC4 antibody, anti ORC4L antibody, anti anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.