You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331176 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ORC3 also known as Origin recognition complex subunit Latheo, whose expression can be detected in the eye and duodenum but is highly expressive in the dura mater and dorsal thalamus. It is found in the nucleus. This protein is a component of the origin recognition complex (ORC) that binds origins of replication while DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3. |
Target | ORC3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 - 1 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: VVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVA |
UniProt ID | Q9UBD5 |
MW | 82kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti-LAT antibody, anti-LATHEO antibody, anti-ORC3 Read more... |
Note | For research use only |
NCBI | NP_862820 |
WB Suggested Anti-ORC3L Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell, ORC3 is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |