You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581846 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to OMA1 |
| Target | OMA1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OMA1 |
| Protein Sequence | Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
| UniProt ID | Q96E52 |
| MW | 60 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | DAB1, MPRP1, MPRP-1, YKR087C, ZMPOMA1, peptidase, Read more... |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_660286 |

Sample Type: HepG2 cells, Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit TBST with 5% BSA, Secondary dilution: 1:5000.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Lung tumor (T-LU), Antibody concentration: 5 ug/ml.

Lanes: Lane 1: 10 ug human fibroblast mitochondria, Lane 2: 15 ug fish embryo lysate; 6 h post fertilization, Lane 3: 30 ug fish embryo lysate, 6 days, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: OMA1.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-OMA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Feline, Gallus, Porcine, Rabbit, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Equine, Feline, Gallus, Porcine, Rabbit, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
IF | |
Bovine, Equine, Feline, Gallus, Porcine, Rabbit, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
RBITC |
IF | |
Bovine, Equine, Feline, Gallus, Porcine, Rabbit, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review