Olfr1386 Rabbit Polyclonal Antibody

SKU: orb326316

Description

Olfr1386 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Olfr1386. It is suitable for WB and is reactive with mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Molecular Biology, Pharmacology & Drug Discovery

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Olfr1386
• Protein Sequence: Synthetic peptide located within the following region: LQPKSSYSESKGKFVALFYTIVTPMLNPLIYTLRNKDVKGALWKVLGRGT
• Molecular Weight: 34kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MOR256-50 antibody

Quick Database Links

Gene Symbol

Olfr1386

RefSeq (Protein):NP_001011741