OBP2A Rabbit Polyclonal Antibody

• Catalog Number: orb582625
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OBP2A
• Target: OBP2A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDY
• UniProt ID: Q9NY56
• MW: 19 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: OBP, LCN13, OBP2C, OBPIIa, hOBPIIa
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_055397

References

S Nakanishi, T Hasegawa, K Maeno, A Motoyama OBP2A regulates epidermal barrier function and protects against cytotoxic small hydrophobic molecules iScience, (2024)

PubMed:

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-OBP2A Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Stomach.