You have no items in your shopping cart.
OBP2A Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | OBP2A |
| Protein Sequence | Synthetic peptide located within the following region: NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDY |
| Molecular Weight | 19 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-OBP2A Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Stomach.
Documents Download
Request a Document
S Nakanishi, T Hasegawa, K Maeno, A Motoyama OBP2A regulates epidermal barrier function and protects against cytotoxic small hydrophobic molecules iScience, (2024)
OBP2A Rabbit Polyclonal Antibody (orb582625)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

