OAS1 Rabbit Polyclonal Antibody

• Catalog Number: orb573653
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OAS1
• Target: OAS1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
• UniProt ID: P00973
• MW: 46kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: OIAS, IFI-4, OIASI, E18/E16
• Note: For research use only
• NCBI: NP_058132, np_058132

Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. OAS1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. OAS1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Positive control (+): Human Stomach Tumor (T-ST), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 3 ug/ml.

Immunohistochemistry with Small intestine tissue at an antibody concentration of 5 ug/ml using anti-OAS1 antibody (orb573653).

WB Suggested Anti-OAS1 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.