Cart summary

You have no items in your shopping cart.

NUTM2B Rabbit Polyclonal Antibody (FITC)

NUTM2B Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2084571

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2084571
CategoryAntibodies
DescriptionNUTM2B Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human NUTM2B
Protein SequenceSynthetic peptide located within the following region: EIPPEVVQEYVDIMEELLGPSLGATGEPEKQREEGKVKQPQEEDWTPPDP
UniProt IDA6NNL0
MW69kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesFAM22B, bA119F19.1
NoteFor research use only
NCBIXP_005270193