NUP50 antibody

• Catalog Number: orb581651
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NUP50
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NUP50
• Concentration: 100 μl at 0.5 - 1 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: NUP50
• UniProt ID: Q9UKX7
• Protein Sequence: Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED
• NCBI: NP_009103
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NPAP60, NPAP60L
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human hela cells tissue using NUP50 antibody

WB analysis of HepG2 tissue using NUP50 antibody

Immunofluorescence analysis of human hela cells tissue using NUP50 antibody