NUP50 Rabbit Polyclonal Antibody

• Catalog Number: orb581651
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NUP50
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NUP50
• Concentration: 100 μl at 0.5 - 1 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: NUP50
• UniProt ID: Q9UKX7
• Protein Sequence: Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED
• NCBI: NP_009103
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NPAP60, NPAP60L
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. NUP50 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that NUP50 is expressed in HepG2.

Sample Type: Hela cell lysate.

WB Suggested Anti-NUP50 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that NUP50 is expressed in HepG2.