Numb antibody

• Catalog Number: orb331043
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Numb
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66kDa
• Target: Numb
• UniProt ID: Q9QZS3
• Protein Sequence: Synthetic peptide located within the following region: ASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTF
• NCBI: NP_035079
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti m-numb antibody, anti mnb antibody, anti m-Nb
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Brain tissue using Numb antibody

Western blot analysis of rat Brain tissue using Numb antibody

Western blot analysis of mouse Brain tissue using Numb antibody