Cart summary

You have no items in your shopping cart.

Nucleocapsid (SARS-CoV-2) Antibody

SKU: orb1463333

Description

The nucleocapsid protein is one of the core components of the SARS coronavirus (CoV). This protein forms a closed capsule, inside which the genomic RNA is securely stored, and it is also involved in packaging the RNA into virus particles.

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:2,000
ReactivityVirus
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

Antibody TypePrimary Antibody
HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Affinity purified recombinant fusion protein using the C-terminal of Nucleocapsid (residues 280 to stop) and produced in E. coli. Antigen Sequence: MQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
TargetNucleocapsid (SARS-CoV-2)
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, 20% glycerol and 0.05% sodium azide
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SARS Coronavirus-2, SARS-CoV-2 NP, SARS-CoV-2 N protein antibody.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Nucleocapsid (SARS-CoV-2) Antibody (orb1463333)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 320.00
DispatchUsually dispatched within 2-3 days
Bulk Enquiry