Nucleocapsid (SARS-CoV-2) Antibody

SKU: orb1463333

Description

The nucleocapsid protein is one of the core components of the SARS coronavirus (CoV). This protein forms a closed capsule, inside which the genomic RNA is securely stored, and it is also involved in packaging the RNA into virus particles.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:500-1:2,000
• Reactivity: Virus
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nucleocapsid (residues 280 to stop) and produced in E. coli. Antigen Sequence: MQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
• Target: Nucleocapsid (SARS-CoV-2)
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

SARS Coronavirus-2, SARS-CoV-2 NP, SARS-CoV-2 N protein antibody.

Quick Database Links

Gene Symbol

Nucleocapsid (SARS-CoV-2)