Cart summary

You have no items in your shopping cart.

NTMT1 Rabbit Polyclonal Antibody (HRP)

NTMT1 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2113997

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113997
CategoryAntibodies
DescriptionNTMT1 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the N region of human NTM1A
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW24 kDa
UniProt IDQ9BV86
Protein SequenceSynthetic peptide located within the following region: KQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA
NCBINP_054783
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesNRMT, NRMT1, NTM1A, AD-003, HOMT1A, C9orf32, METTL
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.
  • METTL11A Rabbit Polyclonal Antibody (HRP) [orb468541]

    IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Porcine

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl