You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326519 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NT5E |
Target | NT5E |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: KAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVP |
UniProt ID | P21589 |
MW | 63 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CD73 antibody, anti E5NT antibody, anti NT an Read more... |
Note | For research use only |
NCBI | NP_002517 |
25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recognizes both the 63 kDa preprotein as well as the processed 57 kDa mature form of these proteins.
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-NT5E Antibody, Titration: 1.0 ug/mL, Positive Control: 721_B Whole Cell.
FC, WB | |
Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |