NT5E Rabbit Polyclonal Antibody

• Catalog Number: orb326519
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NT5E
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit
• Reactivity: Human, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63 kDa
• Target: NT5E
• UniProt ID: P21589
• Protein Sequence: Synthetic peptide located within the following region: KAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVP
• NCBI: NP_002517
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CD73 antibody, anti E5NT antibody, anti NT an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recognizes both the 63 kDa preprotein as well as the processed 57 kDa mature form of these proteins.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-NT5E Antibody, Titration: 1.0 ug/mL, Positive Control: 721_B Whole Cell.