Cart summary

You have no items in your shopping cart.

NSMCE3 Rabbit Polyclonal Antibody (Biotin)

NSMCE3 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2101156

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2101156
CategoryAntibodies
DescriptionNSMCE3 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NDNL2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW34kDa
UniProt IDQ96MG7
Protein SequenceSynthetic peptide located within the following region: IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL
NCBINP_619649
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHCA4, LICS, NSE3, NDNL2, MAGEG1, MAGEL3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.