You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329753 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Nrgn |
Target | Nrgn |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Rat |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: ESACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGECGRKG |
UniProt ID | Q04940 |
MW | 8kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti RC3 antibody |
Note | For research use only |
NCBI | NP_077054 |
Rabbit Anti-NRGN antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-Nrgn Antibody, Titration: 1.0 ug/mL, Positive Control: Rat Brain.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy7 |