NR4A3 Rabbit Polyclonal Antibody

• Catalog Number: orb579530
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR4A3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NR4A3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68kDa
• Target: NR4A3
• UniProt ID: Q92570
• Protein Sequence: Synthetic peptide located within the following region: KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN
• NCBI: AAB02581
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CHN, CSMF, NOR1, MINOR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

WB Suggested Anti-NR4A3 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.