You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592891 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NR2F2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | NR2F2 |
UniProt ID | P24468 |
Protein Sequence | Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP |
NCBI | NP_066285 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ARP1, ARP-1, CHTD4, NF-E3, SRXX5, SVP40, COUPTF2, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Positive control (+): 293T (2T), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.
Rabbit Anti-NR2F2 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Rabbit Anti-NR2F2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB | |
Canine, Mouse, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine, Equine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |