NR2E1 Rabbit Polyclonal Antibody

SKU: orb574040

Description

Rabbit polyclonal antibody to NR2E1

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Application Notes:
  Application Info: IHC Information: Colon, myenteric plexus

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E1
• Target: NR2E1
• Protein Sequence: Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY
• Molecular Weight: 43 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TLL, TLX, XTLL

25 ug of Hela and MCF7 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Sample Tissue: Human NCI-H226 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Human Brain

Human Placenta

Human Prostate

WB Suggested Anti-NR2E1 Antibody Titration: 1 ug/ml, Positive Control: Fetal Muscle cell lysate.

Quick Database Links

Gene Symbol

NR2E1

UniProt

Q9Y466

RefSeq (Protein):NP_003260