NR1I3 Rabbit Polyclonal Antibody

• Catalog Number: orb576186
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR1I3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Mouse
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse NR1I3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: NR1I3
• UniProt ID: O35627
• Protein Sequence: Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS
• NCBI: NP_033933
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: C, CA, mC, CAR, MB67, Care2, ESTM3, ESTM32, AA2099
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Mouse Liver

WB Suggested Anti-NR1I3 Antibody Titration: 5.0 ug/ml, Positive Control: SP2/0 cell lysate.