You have no items in your shopping cart.
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:500-1:5,000 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Host | Goat |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 300 aa to the C-terminus of human NPY1R produced in E. coli. Antigen Sequence: ENKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI |
| Target | Neuropeptide Y receptor Y1 |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. |
| Concentration | Please inquire |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−NPY1R Rabbit Polyclonal Antibody [orb382148]
ICC, IF, IHC-P, WB
Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
100 μgNPY1R Rabbit Polyclonal Antibody [orb578234]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlHuman Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit [orb778096]
Human
0.32-20 ng/mL
0.127 ng/mL
96 T, 48 TMouse Neuropeptide Y Receptor Y1 (NPY1R) ELISA Kit [orb780306]
Mouse
0.16-10 ng/mL
0.057 ng/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Request a Document
NPY1R Antibody (orb611196)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review













