You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578234 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NPY1R |
| Target | NPY1R |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NPY1R |
| Protein Sequence | Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
| UniProt ID | P25929 |
| MW | 44 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | NPYR, NPY1-R |
| Research Area | Cell Biology, Immunology & Inflammation, Pharmacol Read more... |
| Note | For research use only |
| NCBI | NP_000900 |

Immunohistochemistry with gut tissue.

Immunohistochemistry with gut tissue.

Immunohistochemistry with gut tissue.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-NPY1R antibody (orb578234).
ELISA, IF, IHC-Fr, IHC-P, WB | |
Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Gallus, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review