NPY1R Rabbit Polyclonal Antibody

• Catalog Number: orb578234
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NPY1R
• Target: NPY1R
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPY1R
• Protein Sequence: Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI
• UniProt ID: P25929
• MW: 44 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NPYR, NPY1-R
• Research Area: Cell Biology, Immunology & Inflammation, Pharmacol
• Note: For research use only
• NCBI: NP_000900

Immunohistochemistry with gut tissue.

Immunohistochemistry with gut tissue.

Immunohistochemistry with gut tissue.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-NPY1R antibody (orb578234).