TUSC4 Rabbit Polyclonal Antibody

• Catalog Number: orb325588
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NPRL2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUSC4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: NPRL2
• UniProt ID: Q8WTW4
• Protein Sequence: Synthetic peptide located within the following region: MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL
• NCBI: NP_006536
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NPR2L antibody, anti NPRL2 antibody, anti NPR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-TUSC4 Antibody, Catalog Number: orb325588, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, moderate signal, very low tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-TUSC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate, NPRL2 is supported by BioGPS gene expression data to be expressed in OVCAR3.