NOX5 Antibody

• Catalog Number: orb1536711
• Category: Antibodies
• Description: NOX5 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 661-765 of human NOX5 (NP_078781.3). AEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF
• Concentration: 1.863 mg/ml
• Dilution range: IHC, IHC-P (1:100), WB (1:500 - 1:2000)
• Conjugation: Unconjugated
• Target: NOX5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: NOX5, NADPH oxidase 5, NOX5A, NOX5B
• Note: For research use only
• Application notes: Further information: The predicted MW is 64kDa/82kDa/83kDa/84kDa/86kDa, while the observed MW by Western blot was 75kDa.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of extracts of various cell lines.