Cart summary

You have no items in your shopping cart.

NOTCH1 Rabbit Polyclonal Antibody

SKU: orb577050

Description

Rabbit polyclonal antibody to NOTCH1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NOTCH1
TargetNOTCH1
Protein SequenceSynthetic peptide located within the following region: EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Molecular Weight273 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

hN1, AOS5, TAN1, AOVD1

Similar Products

  • Notch1 Rabbit Polyclonal Antibody [orb500788]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Activated Notch1 Rabbit Polyclonal Antibody [orb312158]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Guinea pig, Human, Porcine, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NOTCH1 Rabbit Polyclonal Antibody [orb1294410]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 25 μl
  • NOTCH1 Rabbit Polyclonal Antibody [orb629360]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • NOTCH1 Rabbit Polyclonal Antibody [orb256723]

    IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NOTCH1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Full length NOTCH1 (~273 kDa) is not shown in this experiment, cleavage products of NOTCH1 are detected including the NOTCH Intracellular Domain at 88 kDa.

NOTCH1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

NOTCH1 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

NOTCH1 Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

NOTCH1 Rabbit Polyclonal Antibody

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/ml.

NOTCH1 Rabbit Polyclonal Antibody

Rabbit Anti-NOTCH1 Antibody, Catalog Number: orb577050, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

NOTCH1 Rabbit Polyclonal Antibody

WB Suggested Anti-NOTCH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_060087

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

NOTCH1 Rabbit Polyclonal Antibody (orb577050)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry