You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577050 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NOTCH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NOTCH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 273 kDa |
Target | NOTCH1 |
UniProt ID | P46531 |
Protein Sequence | Synthetic peptide located within the following region: EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK |
NCBI | NP_060087 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | hN1, AOS5, TAN1, AOVD1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Full length NOTCH1 (~273 kDa) is not shown in this experiment, cleavage products of NOTCH1 are detected including the NOTCH Intracellular Domain at 88 kDa.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/ml.
Rabbit Anti-NOTCH1 Antibody, Catalog Number: orb577050, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-NOTCH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |