NOP53 Rabbit Polyclonal Antibody

• Catalog Number: orb326526
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GLTSCR2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Porcine
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: NOP53
• UniProt ID: Q9NZM5
• Protein Sequence: Synthetic peptide located within the following region: LRLAELARRQRRRQARREAEADKPRRLGRLKYQAPDIDVQLSSELTDSLR
• NCBI: NP_056525
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti PICT-1 antibody, anti PICT1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Antibody Dilution: 1.0 ug/mL, Sample Type: 293T cell lysateGLTSCR2 is supported by BioGPS gene expression data to be expressed in HEK293T.