NONO Rabbit Polyclonal Antibody

SKU: orb577744

Description

Rabbit polyclonal antibody to NONO

Research Area

Cancer Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

−

Item 1 of 7

Tested Applications	IF, IHC-P, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human NONO
Target	NONO
Protein Sequence	Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Molecular Weight	52kDa
Purification	Protein A purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	1.0 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human kidney

Human Liver

NONO was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb577744 with 1:200 dilution. Western blot was performed using orb577744 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: NONO IP with orb577744 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Rabbit Anti-NONO Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Sample Type: subnuclear bodies-paraspeckles.

WB Suggested Anti-NONO Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

NONO

UniProt

Q15233

RefSeq (Protein):NP_031389

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_031389

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC-P

Immunohistochemistry Paraffin

View Protocol

Immunofluorescence

View Protocol

Find More Protocols