NONO Rabbit Polyclonal Antibody

• Catalog Number: orb577744
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NONO
• Target: NONO
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NONO
• Protein Sequence: Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
• UniProt ID: Q15233
• MW: 52kDa
• Tested applications: IF, IHC-P, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114
• Research Area: Cancer Biology, Epigenetics & Chromatin, Molecular
• Note: For research use only
• NCBI: NP_031389

Human kidney

Human Liver

NONO was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb577744 with 1:200 dilution. Western blot was performed using orb577744 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: NONO IP with orb577744 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Rabbit Anti-NONO Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-NONO Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Sample Type: subnuclear bodies-paraspeckles.

WB Suggested Anti-NONO Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.