You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582581 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NOMO1 |
| Target | NOMO1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NOMO1 |
| Protein Sequence | Synthetic peptide located within the following region: QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD |
| UniProt ID | P69849 |
| MW | 134kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | PM5, Nomo |
| Research Area | Signal Transduction, Stem Cell & Developmental Bio Read more... |
| Note | For research use only |
| NCBI | NP_055102 |

NOMO1 antibody - C-terminal region (orb582581), Catalog Number: orb582581, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasm in Human Pineal Tissue, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-NOMO1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. NOMO1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
BF750 |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Cy3 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review