NOLC1 Rabbit Polyclonal Antibody

• Catalog Number: orb579675
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NOLC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Reactivity: Human, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NOLC1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 73kDa
• Target: NOLC1
• UniProt ID: Q14978
• Protein Sequence: Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
• NCBI: NP_004732
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P130, Srp40, NOPP130, NOPP140, NS5ATP13
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

Immunohistochemistry with pFa fixed zebrafish kidney tissue at an antibody concentration of 0.004 using anti-NOLC1 antibody (orb579675).

NOLC1 antibody - C-terminal region (orb579675) validated by WB using HepG2 cell lysate at 2.5 ug/ml. NOLC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.