NOCT Rabbit Polyclonal Antibody

• Catalog Number: orb574256
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NOCT
• Target: NOCT
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L
• Protein Sequence: Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD
• UniProt ID: Q9UK39
• MW: 48kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NOC, CCR4L, Ccr4c, CCRN4L
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_036250

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The canonical 48 kDa protein is processed to 40 kDa.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Ovary Tumor (T-OV), Antibody concentration: 3 ug/ml.

Human Lung

Rabbit Anti-CCRN4L antibody, Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CCRN4L Antibody Titration: 1.0-2.0 ug/ml, Positive Control: Daudi cell lysate, CCRN4L is supported by BioGPS gene expression data to be expressed in Daudi.