You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574256 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NOCT |
| Target | NOCT |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L |
| Protein Sequence | Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD |
| UniProt ID | Q9UK39 |
| MW | 48kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | NOC, CCR4L, Ccr4c, CCRN4L |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_036250 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The canonical 48 kDa protein is processed to 40 kDa.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Ovary Tumor (T-OV), Antibody concentration: 3 ug/ml.

Human Lung

Rabbit Anti-CCRN4L antibody, Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CCRN4L Antibody Titration: 1.0-2.0 ug/ml, Positive Control: Daudi cell lysate, CCRN4L is supported by BioGPS gene expression data to be expressed in Daudi.
ELISA, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review