You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb580564 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NMNAT1 |
| Target | NMNAT1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NMNAT1 |
| Protein Sequence | Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL |
| UniProt ID | Q9HAN9 |
| MW | 32kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | LCA9, NMNAT, PNAT1, SHILCA |
| Research Area | Epigenetics & Chromatin, Signal Transduction |
| Note | For research use only |
| NCBI | NP_073624 |

Sample Tissue: Human HCT116, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-NMNAT1 Antibody Titration: 0.25 ug/ml, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Canine, Gallus, Human, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Gallus, Human, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
AP |
WB | |
Bovine, Canine, Gallus, Human, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Gallus, Human, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review