Cart summary

You have no items in your shopping cart.

Nme7 Rabbit Polyclonal Antibody (FITC)

Nme7 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2090433

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090433
CategoryAntibodies
DescriptionNme7 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Nme7
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW44kDa
UniProt IDQ3UMG6
Protein SequenceSynthetic peptide located within the following region: FSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGF
NCBINP_612187
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesNm23-M, Nm23-M7, Nm23-r7, D530024H21Rik
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.