NME1 Rabbit Polyclonal Antibody

• Catalog Number: orb592639
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NME1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: DOT, IHC, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NME1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: NME1
• UniProt ID: P22392
• Protein Sequence: Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH
• NCBI: NP_000260
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NB, AWD, NBS, GAAD, NDKA, NM23, NDPKA, NDPK-A, NM2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-NME1 antibody IHC of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Primary Antibody concentration 5 ug/ml.

Anti-NME1 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Primary Antibody concentration 5 ug/ml.

DB Suggested Anti-Nme1 antibody, Titration: 0.5 ug/ml, Positive Control: Recomninant human NME2 protein.

Human kidney

Lanes: 1. 20 ug murine 4T1 primary breast tumor cell lysate, 2. 20 ug human MDA-MB-231 cell lysate, 3. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: NME1.

Lanes: 1. 20 ug murine 4T1 primary breast tumor cell lysate, 2. 20 ug human MDA-MB-231 cell lysate, 3. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: NME1.

NME1 antibody - N-terminal region (orb592639) validated by WB using Fetal Heart Lysate at 1 ug/ml.