NME1 Rabbit Polyclonal Antibody

SKU: orb592639

Description

Rabbit polyclonal antibody to NME1

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: DOT, IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NME1
• Target: NME1
• Protein Sequence: Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH
• Molecular Weight: 17kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NB, AWD, NBS, GAAD, NDKA, NM23, NDPKA, NDPK-A, NM23-H1

Anti-NME1 antibody IHC of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Primary Antibody concentration 5 ug/ml.

Anti-NME1 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Primary Antibody concentration 5 ug/ml.

DB Suggested Anti-Nme1 antibody, Titration: 0.5 ug/ml, Positive Control: Recomninant human NME2 protein.

Human kidney

Lanes: 1. 20 ug murine 4T1 primary breast tumor cell lysate, 2. 20 ug human MDA-MB-231 cell lysate, 3. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: NME1.

Lanes: 1. 20 ug murine 4T1 primary breast tumor cell lysate, 2. 20 ug human MDA-MB-231 cell lysate, 3. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: NME1.

NME1 antibody - N-terminal region (orb592639) validated by WB using Fetal Heart Lysate at 1 ug/ml.

Quick Database Links

Gene Symbol

NME1

UniProt

P22392

RefSeq (Protein):NP_000260