NKX6-1 Rabbit Polyclonal Antibody

SKU: orb574354

Description

Rabbit polyclonal antibody to NKX6-1

Research Area

Epigenetics & Chromatin, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKX6-1
• Target: NKX6-1
• Protein Sequence: Synthetic peptide located within the following region: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSS
• Molecular Weight: 38 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NKX6A, NKX6.1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 1 ug/ml.

WB Suggested Anti-NKX6-1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Small Intestine.

Quick Database Links

Gene Symbol

NKX6-1

UniProt

P78426

RefSeq (Protein):NP_006159