Nkx2-3 Rabbit Polyclonal Antibody

• Catalog Number: orb324670
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Nkx2-3
• Target: Nkx2-3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Guinea pig, Human, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of mouse Nkx2-3
• Protein Sequence: Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG
• UniProt ID: P97334
• MW: 38 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Nkx-2.3 antibody, anti Nkx2.3 antibody, anti
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_032725

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Only 39 kDa is known to contain immunogen.

IHC Information: Paraffin embedded mouse lymphoid tissue (skeletal muscle) tissue, tested with an antibody dilution of 5 ug/mL.

IHC Information: Paraffin embedded spleenlympho tissue, tested with an antibody dilution of 5 ug/mL.

WB Suggested Anti-Nkx2-3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Uterus.