You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb324447 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NKX2-3 |
| Target | NKX2-3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NKX2-3 |
| Protein Sequence | Synthetic peptide located within the following region: ADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHG |
| UniProt ID | Q8TAU0 |
| MW | 32kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CSX3 antibody, anti NK2.3 antibody, anti NKX2 Read more... |
| Research Area | Epigenetics & Chromatin, Stem Cell & Developmental Read more... |
| Note | For research use only |
| NCBI | NP_660328 |

lane 1: Mouse Spleen lysate, primary antibody Dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody Dilution: 1:10000, blocking buffer: 3% milk in TBST.

WB Suggested Anti-NKX2-3 Antibody Titration: 0.25 ug/mL, Positive Control: Human Spleen.
IHC, WB | |
Bovine, Guinea pig, Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review