NKX2-3 Rabbit Polyclonal Antibody

• Catalog Number: orb324447
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NKX2-3
• Target: NKX2-3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKX2-3
• Protein Sequence: Synthetic peptide located within the following region: ADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHG
• UniProt ID: Q8TAU0
• MW: 32kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CSX3 antibody, anti NK2.3 antibody, anti NKX2
• Research Area: Epigenetics & Chromatin, Stem Cell & Developmental
• Note: For research use only
• NCBI: NP_660328

lane 1: Mouse Spleen lysate, primary antibody Dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody Dilution: 1:10000, blocking buffer: 3% milk in TBST.

WB Suggested Anti-NKX2-3 Antibody Titration: 0.25 ug/mL, Positive Control: Human Spleen.