You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586557 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NKAP |
Target | NKAP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human NKAP |
Protein Sequence | Synthetic peptide located within the following region: EAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGK |
UniProt ID | Q8N5F7 |
MW | 46kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MRXSHD |
Note | For research use only |
NCBI | NP_078804 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-NKAP Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell.
ELISA, IF, IHC-Fr, IHC-P | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine, Equine, Human, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |