You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578906 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NIPSNAP3B |
| Target | NIPSNAP3B |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human NIPSNAP3B |
| Protein Sequence | Synthetic peptide located within the following region: GPRQYDGTFYEFRTYYLKPSNMNAFMENLKKNIHLRTSYSELVGFWSVEF |
| UniProt ID | F2Z3L7 |
| MW | 21kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | FP944, SNAP1, NIPSNAP3 |
| Note | For research use only |
| NCBI | XP_011517141.1 |
| Expiration Date | 12 months from date of receipt. |

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
IHC-P, WB | |
Human | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |