Cart summary

You have no items in your shopping cart.

NINL Rabbit Polyclonal Antibody (Biotin)

NINL Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2116909

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2116909
CategoryAntibodies
DescriptionNINL Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human NINL
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW113kDa
UniProt IDQ9Y2I6
Protein SequenceSynthetic peptide located within the following region: DLERAEKRNLEFVKEMDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVE
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesNLP
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.