You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331196 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NIF3L1 |
Target | NIF3L1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Goat, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human NIF3L1 |
Protein Sequence | Synthetic peptide located within the following region: LDKVMSAVKGIDGVSVTSFSARTGNEEQTRINLNCTQKALMQVVDFLSRN |
UniProt ID | Q9GZT8 |
MW | 27kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CALS-7, MDS015, ALS2CR1 |
Note | For research use only |
NCBI | NP_001129511.1 |
Sample Type: U937 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |