NFYC Rabbit Polyclonal Antibody

• Catalog Number: orb576946
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFYC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NFYC
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: NFYC
• UniProt ID: Q13952
• Protein Sequence: Synthetic peptide located within the following region: GTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPA
• NCBI: NP_055038
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HSM, CBFC, HAP5, CBF-C, NF-YC, H1TF2A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

Human Liver

WB Suggested Anti-NFYC Antibody Titration: 0.25 ug/ml, Positive Control: 293T cells lysate. There is BioGPS gene expression data showing that NFYC is expressed in HEK293T.