NFKBIB Rabbit Polyclonal Antibody

SKU: orb575059

Description

Rabbit polyclonal antibody to NFKBIB

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Protein Biochemistry, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFKBIB
• Target: NFKBIB
• Protein Sequence: Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL
• Molecular Weight: 38kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

IKBB, TRIP9

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 100 ug mouse liver lysate, Lane 2: 100 ug mouse brain lysate, Lane 3: 100 ug mouse heart lysate, Lane 4: 100 ug mouse kidney lysate, Lane 5: 100 ug mouse lung lysate, Lane 6: 100 ug mouse thymus lysate, Lane 7: 100 ug mouse spleen lysate, Lane 8: 100 ug mouse testis lysate, Lane 9: 100 ug HeLa cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-AP, Secondary Antibody dilution: 1:10000, Gene Name: NFKBIB.

WB Suggested Anti-NFKBIB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Jurkat cell lysate, NFKBIB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

NFKBIB

UniProt

Q15653

RefSeq (Protein):NP_002494