NFIX Rabbit Polyclonal Antibody

• Catalog Number: orb574352
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFIX
• Target: NFIX
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFIX
• Protein Sequence: Synthetic peptide located within the following region: YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRV
• UniProt ID: Q14938
• MW: 49kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CTF, NF1A, NF1-X, MRSHSS, NF-I/X, SOTOS2
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_002492

DG of Hippocampus, dilution: 1:200.

Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-NFIX antibody (orb574352).

WB Suggested Anti-NFIX Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.