You have no items in your shopping cart.
Cart summary
Nfia Peptide - middle region
Catalog Number: orb2005681
| Catalog Number | orb2005681 |
|---|---|
| Category | Proteins |
| Description | Nfia Peptide - middle region |
| Predicted Reactivity | Human, Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: YLAYFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTE |
| UniProt ID | Q02780 |
| MW | 58kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with Nfia Rabbit Polyclonal Antibody (orb574026). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | 1110047K16Rik, 9430022M17Rik, NF1-A, NF1A |
| Note | For research use only |
| NCBI | NP_001116424 |
