You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2005681 |
---|---|
Category | Proteins |
Description | Nfia Peptide - middle region |
Predicted Reactivity | Human, Mouse |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | Synthetic peptide located within the following region: YLAYFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTE |
UniProt ID | Q02780 |
MW | 58kDa |
Tested applications | WB |
Application notes | This is a synthetic peptide designed for use in combination with Nfia Rabbit Polyclonal Antibody (orb574026). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | 1110047K16Rik, 9430022M17Rik, NF1-A, NF1A |
Note | For research use only |
NCBI | NP_001116424 |